Lineage for d1z5fa_ (1z5f A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535185Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2535186Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2535187Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2535659Protein automated matches [190061] (7 species)
    not a true protein
  7. 2535660Species Bullfrog (Rana catesbeiana) [TaxId:8400] [255002] (1 PDB entry)
  8. 2535661Domain d1z5fa_: 1z5f A: [241109]
    automated match to d1oj1a_

Details for d1z5fa_

PDB Entry: 1z5f (more details)

PDB Description: solution structure of the cytotoxic rc-rnase 3 with a pyroglutamate residue at the n-terminus
PDB Compounds: (A:) RC-RNase 3

SCOPe Domain Sequences for d1z5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5fa_ d.5.1.1 (A:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
edwetfqkkhltdtkkvkcdvemakalfdckktntfiyalpgrvkalcknirdntdvlsr
dafllpqcdriklpchyklssstnticitcvnqlpihfagvgscp

SCOPe Domain Coordinates for d1z5fa_:

Click to download the PDB-style file with coordinates for d1z5fa_.
(The format of our PDB-style files is described here.)

Timeline for d1z5fa_: