SCOPe 2.04: Domain d1z5fa_: 1z5f A:

Lineage for d1z5fa_ (1z5f A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (6 species)
   not a true protein

7. Species Bullfrog (Rana catesbeiana) [TaxId:8400] [255002] (1 PDB entry)

8. Domain d1z5fa_: 1z5f A: [241109]
   automated match to d1oj1a_

Details for d1z5fa_

PDB Entry: 1z5f

PDB Description: solution structure of the cytotoxic rc-rnase 3 with a pyroglutamate residue at the n-terminus

PDB Compounds: (A:) RC-RNase 3

SCOPe Domain Sequences for d1z5fa_:

Sequence; same for both SEQRES and ATOM records:

>d1z5fa_ d.5.1.1 (A:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
edwetfqkkhltdtkkvkcdvemakalfdckktntfiyalpgrvkalcknirdntdvlsr
dafllpqcdriklpchyklssstnticitcvnqlpihfagvgscp

Timeline for d1z5fa_:

• d1z5fa_ is new in SCOPe 2.04-stable
  
• d1z5fa_ appears in SCOPe 2.05
  
• d1z5fa_ appears in the current release, SCOPe 2.08