SCOPe 2.07: Domain d1z3ra1: 1z3r A:3-99

Lineage for d1z3ra1 (1z3r A:3-99)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Omsk hemorrhagic fever virus [TaxId:12542] [254999] (1 PDB entry)

8. Domain d1z3ra1: 1z3r A:3-99 [241108]
   Other proteins in same PDB: d1z3ra2
   automated match to d1pjwa_

Details for d1z3ra1

PDB Entry: 1z3r

PDB Description: solution structure of the omsk hemhorraghic fever envelope protein domain iii

PDB Compounds: (A:) Polyprotein

SCOPe Domain Sequences for d1z3ra1:

Sequence; same for both SEQRES and ATOM records:

>d1z3ra1 b.1.18.0 (A:3-99) automated matches {Omsk hemorrhagic fever virus [TaxId: 12542]}
kgltytmcdkakftwkraptdsghdtvvmevafsgtkpcripvravahgapdvdvamlit
pnptmenngggfiemqlppgdniiyvgelkhqwfqkg

Timeline for d1z3ra1:

• d1z3ra1 first appeared in SCOPe 2.04, called d1z3ra_
  
• d1z3ra1 appears in SCOPe 2.06
  
• d1z3ra1 appears in the current release, SCOPe 2.08