![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Omsk hemorrhagic fever virus [TaxId:12542] [254999] (1 PDB entry) |
![]() | Domain d1z3ra1: 1z3r A:3-99 [241108] Other proteins in same PDB: d1z3ra2 automated match to d1pjwa_ |
PDB Entry: 1z3r (more details)
SCOPe Domain Sequences for d1z3ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3ra1 b.1.18.0 (A:3-99) automated matches {Omsk hemorrhagic fever virus [TaxId: 12542]} kgltytmcdkakftwkraptdsghdtvvmevafsgtkpcripvravahgapdvdvamlit pnptmenngggfiemqlppgdniiyvgelkhqwfqkg
Timeline for d1z3ra1: