SCOPe 2.06: Domain d1z3ka_: 1z3k A:

Lineage for d1z3ka_ (1z3k A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (49 PDB entries)

8. Domain d1z3ka_: 1z3k A: [241107]
   automated match to d2ciaa_

Details for d1z3ka_

PDB Entry: 1z3k

PDB Description: structural insight into the binding diversity between the tyr- phosphorylated human ephrinbs and nck2 sh2 domain

PDB Compounds: (A:) Cytoplasmic protein NCK2

SCOPe Domain Sequences for d1z3ka_:

Sequence; same for both SEQRES and ATOM records:

>d1z3ka_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rewyygnvtrhqaecalnergvegdflirdsesspsdfsvslkasgknkhfkvqlvdnvy
cigqrrfhtmdelvehykkapiftsehgeklylvralq

Timeline for d1z3ka_:

• d1z3ka_ first appeared in SCOPe 2.04
  
• d1z3ka_ appears in SCOPe 2.05
  
• d1z3ka_ appears in SCOPe 2.07
  
• d1z3ka_ appears in the current release, SCOPe 2.08