Lineage for d1z3ka_ (1z3k A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530930Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2530931Protein automated matches [190561] (4 species)
    not a true protein
  7. 2530932Species Human (Homo sapiens) [TaxId:9606] [187549] (76 PDB entries)
  8. 2531025Domain d1z3ka_: 1z3k A: [241107]
    automated match to d2ciaa_

Details for d1z3ka_

PDB Entry: 1z3k (more details)

PDB Description: Structural Insight into the Binding Diversity between the Tyr-Phosphorylated Human EphrinBs and Nck2 SH2 Domain
PDB Compounds: (A:) Cytoplasmic protein NCK2

SCOPe Domain Sequences for d1z3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3ka_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rewyygnvtrhqaecalnergvegdflirdsesspsdfsvslkasgknkhfkvqlvdnvy
cigqrrfhtmdelvehykkapiftsehgeklylvralq

SCOPe Domain Coordinates for d1z3ka_:

Click to download the PDB-style file with coordinates for d1z3ka_.
(The format of our PDB-style files is described here.)

Timeline for d1z3ka_: