| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.17: Cysteine alpha-hairpin motif [47071] (1 superfamily) core: alpha-hairpin crosslinked with two disulfides |
Superfamily a.17.1: Cysteine alpha-hairpin motif [47072] (2 families) ![]() |
| Family a.17.1.2: COX17-like [117033] (2 proteins) Pfam PF05051 |
| Protein automated matches [254466] (1 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254997] (1 PDB entry) |
| Domain d1z2ga_: 1z2g A: [241106] automated match to d1u97a_ |
PDB Entry: 1z2g (more details)
SCOPe Domain Sequences for d1z2ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z2ga_ a.17.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtetdkkqeqenhaecedkpkpccvckpekeerdtcilfngqdsekckefiekykecmkg
ygfevpsan
Timeline for d1z2ga_: