Lineage for d1z2ga_ (1z2g A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697851Fold a.17: Cysteine alpha-hairpin motif [47071] (1 superfamily)
    core: alpha-hairpin crosslinked with two disulfides
  4. 2697852Superfamily a.17.1: Cysteine alpha-hairpin motif [47072] (2 families) (S)
  5. 2697858Family a.17.1.2: COX17-like [117033] (2 proteins)
    Pfam PF05051
  6. 2697863Protein automated matches [254466] (1 species)
    not a true protein
  7. 2697864Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254997] (1 PDB entry)
  8. 2697865Domain d1z2ga_: 1z2g A: [241106]
    automated match to d1u97a_

Details for d1z2ga_

PDB Entry: 1z2g (more details)

PDB Description: solution structure of apo, oxidized yeast cox17
PDB Compounds: (A:) Cytochrome c oxidase copper chaperone

SCOPe Domain Sequences for d1z2ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2ga_ a.17.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtetdkkqeqenhaecedkpkpccvckpekeerdtcilfngqdsekckefiekykecmkg
ygfevpsan

SCOPe Domain Coordinates for d1z2ga_:

Click to download the PDB-style file with coordinates for d1z2ga_.
(The format of our PDB-style files is described here.)

Timeline for d1z2ga_: