SCOPe 2.05: Domain d1z1wa4: 1z1w A:490-780

Lineage for d1z1wa4 (1z1w A:490-780)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.26: ERAP1 C-terminal-like [254170] (3 proteins)
   Pfam PF11838; PubMed 15893768
   this is a repeat family; one repeat unit is 2xdt A:843-881 found in domain

6. Protein Tricorn protease interacting factor F3 C-terminal domain [254385] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [254818] (2 PDB entries)

8. Domain d1z1wa4: 1z1w A:490-780 [241105]
   Other proteins in same PDB: d1z1wa1, d1z1wa2, d1z1wa3
   complexed with so4, zn

Details for d1z1wa4

PDB Entry: 1z1w, 2.7 Å

PDB Description: Crystal structures of the tricorn interacting facor F3 from Thermoplasma acidophilum, a zinc aminopeptidase in three different conformations

PDB Compounds: (A:) Tricorn protease interacting factor F3

SCOPe Domain Sequences for d1z1wa4:

Sequence; same for both SEQRES and ATOM records:

>d1z1wa4 a.118.1.26 (A:490-780) Tricorn protease interacting factor F3 C-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
datfsdvmghyrdlspldriglvddlfafllsghidpetyrqrirnffddedhnvitaiv
gqmeylrmlthafdddarafcrsrmqfltgkqdenlkialgrvsrlyvmvdesyaeemsk
lfkdfdsaepemrssiatayalvtgdlkgllekfrsvdrdedrvriisafgklksntdls
tvygmvekteikkqdmisffssaletlpgrefifanldriirlviryftgnrtasrtvem
mipvigldhpdaedivrnigsknismglakgiemlavnrklverirqtavk

Timeline for d1z1wa4:

• d1z1wa4 first appeared in SCOPe 2.04
  
• d1z1wa4 appears in SCOPe 2.06
  
• d1z1wa4 appears in the current release, SCOPe 2.08