![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.26: ERAP1 C-terminal-like [254170] (3 proteins) Pfam PF11838; PubMed 15893768 this is a repeat family; one repeat unit is 2xdt A:843-881 found in domain |
![]() | Protein Tricorn protease interacting factor F3 C-terminal domain [254385] (1 species) |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [254818] (2 PDB entries) |
![]() | Domain d1z1wa4: 1z1w A:490-780 [241105] Other proteins in same PDB: d1z1wa1, d1z1wa2, d1z1wa3 complexed with so4, zn applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1z1w (more details), 2.7 Å
SCOPe Domain Sequences for d1z1wa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1wa4 a.118.1.26 (A:490-780) Tricorn protease interacting factor F3 C-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} datfsdvmghyrdlspldriglvddlfafllsghidpetyrqrirnffddedhnvitaiv gqmeylrmlthafdddarafcrsrmqfltgkqdenlkialgrvsrlyvmvdesyaeemsk lfkdfdsaepemrssiatayalvtgdlkgllekfrsvdrdedrvriisafgklksntdls tvygmvekteikkqdmisffssaletlpgrefifanldriirlviryftgnrtasrtvem mipvigldhpdaedivrnigsknismglakgiemlavnrklverirqtavk
Timeline for d1z1wa4: