Lineage for d1z1nx_ (1z1n X:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012598Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2012599Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2012896Family a.138.1.0: automated matches [227152] (1 protein)
    not a true family
  6. 2012897Protein automated matches [226857] (4 species)
    not a true protein
  7. 2012904Species Desulfovibrio gigas [TaxId:879] [254995] (1 PDB entry)
  8. 2012905Domain d1z1nx_: 1z1n X: [241101]
    automated match to d1h29a_
    complexed with gol, hec, zn

Details for d1z1nx_

PDB Entry: 1z1n (more details), 2.1 Å

PDB Description: Crystal Structure of the sixteen heme cytochrome from Desulfovibrio gigas
PDB Compounds: (X:) sixteen heme cytochrome

SCOPe Domain Sequences for d1z1nx_:

Sequence, based on SEQRES records: (download)

>d1z1nx_ a.138.1.0 (X:) automated matches {Desulfovibrio gigas [TaxId: 879]}
pkvdaividtaavfgkleqpgvvfyhekhttalekmakdctschvetegklsfkfartvd
ptsknamaeqyhancmachekvvgsyptapqaaeckrchvgpgvegatvtpkpsldlnlh
grhvvaeakrlqvkedesckachhtydeaqkklvyakgeegscvychkqeplpspvqqdr
vvpstrdashescvnchlstrkaqtesgpvlcvgchtaeaqaawkktaetprlfrgqpda
tllvagaatangtvdvnwaaagpgpvafdhkahegfvgncvtchhptqtggslaacgvac
htttgskdgnfvttaqsahqlgvttscvgchttqanarkecagchapmqktalsqnsciq
cheagfptsgtqtlgkeereataakilaakdekpktvplenvpekltlnymdekgdewqa
aefphrkiyqklveeaakspmanhfhgdaltmcsgchhnakpslnppkcaschskpfqer
tanqpglkgafhnqcigchqemqvnpkatdcqgchkpkns

Sequence, based on observed residues (ATOM records): (download)

>d1z1nx_ a.138.1.0 (X:) automated matches {Desulfovibrio gigas [TaxId: 879]}
pkvdaividtaavfgkleqpgvvfyhekhttalekmakdctschvetegklsfkfartvd
ptsknamaeqyhancmachekvvgsyptapqaaeckrchvgpgvegatvtpkpsldlnlh
grhvvaeakrlqvkedesckachhtydeaqkklvyakgeegscvychkqeplpspvdrvv
pstrdashescvnchlstrkaqtesgpvlcvgchtaeaqaawkktaetprlfrgqpdatl
lvagaatangtvdvnwaaagpgpvafdhkahegfvgncvtchhptqtggslaacgvacht
ttgskdgnfvttaqsahqlgvttscvgchttqanarkecagchapmqktalsqnsciqch
eagfptsgtqtlgkeereataakilaakdekpktvplenvpekltlnymkgdewqaaefp
hrkiyqklveeaakspmanhfhgdaltmcsgchhnakpslnppkcaschskpfqertanq
pglkgafhnqcigchqemqvnpkatdcqgchkpkns

SCOPe Domain Coordinates for d1z1nx_:

Click to download the PDB-style file with coordinates for d1z1nx_.
(The format of our PDB-style files is described here.)

Timeline for d1z1nx_: