SCOPe 2.04: Domain d1z1ma_: 1z1m A:

Lineage for d1z1ma_ (1z1m A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein automated matches [254465] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254996] (2 PDB entries)

8. Domain d1z1ma_: 1z1m A: [241100]
   automated match to d4hbma_

Details for d1z1ma_

PDB Entry: 1z1m

PDB Description: nmr structure of unliganded mdm2

PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d1z1ma_:

Sequence; same for both SEQRES and ATOM records:

>d1z1ma_ a.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdss

Timeline for d1z1ma_:

• d1z1ma_ is new in SCOPe 2.04-stable
  
• d1z1ma_ appears in SCOPe 2.05
  
• d1z1ma_ appears in the current release, SCOPe 2.08, called d1z1ma1