![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
![]() | Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) ![]() binds to the transactivation domain of human p53 |
![]() | Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
![]() | Protein automated matches [254465] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254996] (3 PDB entries) |
![]() | Domain d1z1ma1: 1z1m A:1-118 [241100] Other proteins in same PDB: d1z1ma2 automated match to d4hbma_ |
PDB Entry: 1z1m (more details)
SCOPe Domain Sequences for d1z1ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1ma1 a.42.1.1 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]} mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessds
Timeline for d1z1ma1: