Lineage for d1z1ma1 (1z1m A:1-118)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712543Protein automated matches [254465] (1 species)
    not a true protein
  7. 2712544Species Human (Homo sapiens) [TaxId:9606] [254996] (3 PDB entries)
  8. 2712547Domain d1z1ma1: 1z1m A:1-118 [241100]
    Other proteins in same PDB: d1z1ma2
    automated match to d4hbma_

Details for d1z1ma1

PDB Entry: 1z1m (more details)

PDB Description: nmr structure of unliganded mdm2
PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d1z1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1ma1 a.42.1.1 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessds

SCOPe Domain Coordinates for d1z1ma1:

Click to download the PDB-style file with coordinates for d1z1ma1.
(The format of our PDB-style files is described here.)

Timeline for d1z1ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z1ma2