SCOPe 2.07: Domain d1z1ma1: 1z1m A:1-118

Lineage for d1z1ma1 (1z1m A:1-118)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 protein domains)
   Pfam PF02201

6. Protein automated matches [254465] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254996] (3 PDB entries)

8. Domain d1z1ma1: 1z1m A:1-118 [241100]
   Other proteins in same PDB: d1z1ma2
   automated match to d4hbma_

Details for d1z1ma1

PDB Entry: 1z1m

PDB Description: NMR structure of unliganded MDM2

PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d1z1ma1:

Sequence; same for both SEQRES and ATOM records:

>d1z1ma1 a.42.1.1 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessds

Timeline for d1z1ma1:

• d1z1ma1 first appeared in SCOPe 2.04, called d1z1ma_
  
• d1z1ma1 appears in SCOPe 2.06