SCOPe 2.04: Domain d1z0vf_: 1z0v F:

Lineage for d1z0vf_ (1z0v F:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (16 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [225000] (7 PDB entries)

8. Domain d1z0vf_: 1z0v F: [241099]
   automated match to d1z0wa_

Details for d1z0vf_

PDB Entry: 1z0v, 3 Å

PDB Description: crystal structure of a. fulgidus lon proteolytic domain

PDB Compounds: (F:) Putative protease La homolog type

SCOPe Domain Sequences for d1z0vf_:

Sequence, based on SEQRES records:

>d1z0vf_ d.14.1.0 (F:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn
vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs
lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl
ehvledgkkknrlmskfk

Sequence, based on observed residues (ATOM records):

>d1z0vf_ d.14.1.0 (F:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa
iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv
kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv
ledgkkknrlmskfk

Timeline for d1z0vf_:

• d1z0vf_ is new in SCOPe 2.04-stable
  
• d1z0vf_ appears in SCOPe 2.05
  
• d1z0vf_ appears in the current release, SCOPe 2.08