![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (23 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [225000] (7 PDB entries) |
![]() | Domain d1z0vb_: 1z0v B: [241095] automated match to d1z0wa_ |
PDB Entry: 1z0v (more details), 3 Å
SCOPe Domain Sequences for d1z0vb_:
Sequence, based on SEQRES records: (download)
>d1z0vb_ d.14.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} klfitegyevgrvnglavigesagivlpiiaevtpsmsksegrviatgrlqeiareavmn vsaiikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgs lsvkgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevl ehvledgkkknrlmskfk
>d1z0vb_ d.14.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsa iikkytgrdisnmdvhiqfvgtyegvegdsasisiatavisaiegipvdqsvamtgslsv kgevlpvggvtqkieaaiqaglkkviipkdniddvlldaehegkievipvsrinevlehv ledgkkknrlmskfk
Timeline for d1z0vb_: