Lineage for d1yyhb_ (1yyh B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563231Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2563232Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2563233Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
  6. 2563325Protein automated matches [190101] (7 species)
    not a true protein
  7. 2563347Species Human (Homo sapiens) [TaxId:9606] [187689] (9 PDB entries)
  8. 2563351Domain d1yyhb_: 1yyh B: [241087]
    Other proteins in same PDB: d1yyha2
    automated match to d2f8ya_

Details for d1yyhb_

PDB Entry: 1yyh (more details), 1.9 Å

PDB Description: crystal structure of the human notch 1 ankyrin domain
PDB Compounds: (B:) Notch 1, ankyrin domain

SCOPe Domain Sequences for d1yyhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyhb_ d.211.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilirnra
tdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvdaav
vllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaqerm
hhdivrlld

SCOPe Domain Coordinates for d1yyhb_:

Click to download the PDB-style file with coordinates for d1yyhb_.
(The format of our PDB-style files is described here.)

Timeline for d1yyhb_: