SCOPe 2.05: Domain d1yy7b2: 1yy7 B:88-213

Lineage for d1yy7b2 (1yy7 B:88-213)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (51 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226439] (3 PDB entries)

8. Domain d1yy7b2: 1yy7 B:88-213 [241085]
   Other proteins in same PDB: d1yy7a1, d1yy7b1
   automated match to d4hoja2
   complexed with cit

Details for d1yy7b2

PDB Entry: 1yy7, 2.02 Å

PDB Description: Crystal structure of stringent starvation protein A (SspA), an RNA polymerase-associated transcription factor

PDB Compounds: (B:) stringent starvation protein A

SCOPe Domain Sequences for d1yy7b2:

Sequence; same for both SEQRES and ATOM records:

>d1yy7b2 a.45.1.0 (B:88-213) automated matches {Yersinia pestis [TaxId: 632]}
lmpvypvargssrlmmhriehdwysllykieqgnaqeaeaarkqlreellsiapvfnetp
ffmseefslvdcylapllwrlpvlgieftgagskelkgymtrvferdaflaslteaerem
hlktrs

Timeline for d1yy7b2:

• d1yy7b2 first appeared in SCOPe 2.04
  
• d1yy7b2 appears in SCOPe 2.06
  
• d1yy7b2 appears in the current release, SCOPe 2.08