Lineage for d1yy7b2 (1yy7 B:88-213)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714345Species Yersinia pestis [TaxId:632] [226439] (3 PDB entries)
  8. 2714349Domain d1yy7b2: 1yy7 B:88-213 [241085]
    Other proteins in same PDB: d1yy7a1, d1yy7b1
    automated match to d4hoja2
    complexed with cit

Details for d1yy7b2

PDB Entry: 1yy7 (more details), 2.02 Å

PDB Description: Crystal structure of stringent starvation protein A (SspA), an RNA polymerase-associated transcription factor
PDB Compounds: (B:) stringent starvation protein A

SCOPe Domain Sequences for d1yy7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yy7b2 a.45.1.0 (B:88-213) automated matches {Yersinia pestis [TaxId: 632]}
lmpvypvargssrlmmhriehdwysllykieqgnaqeaeaarkqlreellsiapvfnetp
ffmseefslvdcylapllwrlpvlgieftgagskelkgymtrvferdaflaslteaerem
hlktrs

SCOPe Domain Coordinates for d1yy7b2:

Click to download the PDB-style file with coordinates for d1yy7b2.
(The format of our PDB-style files is described here.)

Timeline for d1yy7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yy7b1