Lineage for d1yx8a_ (1yx8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711647Species Haemopis marmorata [TaxId:38567] [254994] (2 PDB entries)
  8. 2711648Domain d1yx8a_: 1yx8 A: [241081]
    automated match to d1h4ba_

Details for d1yx8a_

PDB Entry: 1yx8 (more details)

PDB Description: nmr structure of calsensin, 20 low energy structures.
PDB Compounds: (A:) Calsensin

SCOPe Domain Sequences for d1yx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yx8a_ a.39.1.0 (A:) automated matches {Haemopis marmorata [TaxId: 38567]}
mackvkaeleaafkkldangdgyvtalelqtfmvtldaykalskdkvkeasaklikmadk
nsdgkiskeeflnanaellcqlk

SCOPe Domain Coordinates for d1yx8a_:

Click to download the PDB-style file with coordinates for d1yx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1yx8a_: