Lineage for d1qmo.3 (1qmo C:,G:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294478Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 294600Protein Legume lectin [49904] (22 species)
  7. 294635Species Field bean (Dolichos lab lab), Fril [49914] (1 PDB entry)
    a legume lectin that delays hematopoietic progenitor maturation
  8. 294638Domain d1qmo.3: 1qmo C:,G: [24108]

Details for d1qmo.3

PDB Entry: 1qmo (more details), 3.5 Å

PDB Description: structure of fril, a legume lectin that delays hematopoietic progenitor maturation

SCOP Domain Sequences for d1qmo.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qmo.3 b.29.1.1 (C:,G:) Legume lectin {Field bean (Dolichos lab lab), Fril}
aqslsfsftkfdpnqedlifqghatstnnvlqvtkldsagnpvsssagrvlysaplrlwe
dsavltsfdtiinfeistpytsriadglaffiappdsvisyhggflglfpnanXsnvvav
efdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrlsvtsyy
agskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtn

SCOP Domain Coordinates for d1qmo.3:

Click to download the PDB-style file with coordinates for d1qmo.3.
(The format of our PDB-style files is described here.)

Timeline for d1qmo.3: