SCOPe 2.08: Domain d1qmo.3: 1qmo C:,G:

Lineage for d1qmo.3 (1qmo C:,G:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Field bean (Dolichos lablab), Fril [TaxId:35936] [49914] (1 PDB entry)
   a legume lectin that delays hematopoietic progenitor maturation

8. Domain d1qmo.3: 1qmo C:,G: [24108]
   complexed with ca, man, mn

Details for d1qmo.3

PDB Entry: 1qmo, 3.5 Å

PDB Description: structure of fril, a legume lectin that delays hematopoietic progenitor maturation

PDB Compounds: (C:) mannose binding lectin, fril, (G:) mannose binding lectin, fril

SCOPe Domain Sequences for d1qmo.3:

Sequence; same for both SEQRES and ATOM records:

>g1qmo.3 b.29.1.1 (C:,G:) Legume lectin {Field bean (Dolichos lablab), Fril [TaxId: 35936]}
aqslsfsftkfdpnqedlifqghatstnnvlqvtkldsagnpvsssagrvlysaplrlwe
dsavltsfdtiinfeistpytsriadglaffiappdsvisyhggflglfpnanXsnvvav
efdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrlsvtsyy
agskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtn

Timeline for d1qmo.3:

• d1qmo.3 first appeared (with stable ids) in SCOP 1.55
  
• d1qmo.3 appears in SCOPe 2.07