Lineage for d1ywwa_ (1yww A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716388Superfamily a.60.11: Hypothetical protein YjbJ [69047] (2 families) (S)
    automatically mapped to Pfam PF05532
  5. 2716394Family a.60.11.0: automated matches [254209] (1 protein)
    not a true family
  6. 2716395Protein automated matches [254464] (1 species)
    not a true protein
  7. 2716396Species Pseudomonas aeruginosa [TaxId:287] [254993] (1 PDB entry)
  8. 2716397Domain d1ywwa_: 1yww A: [241078]
    automated match to d1ryka_

Details for d1ywwa_

PDB Entry: 1yww (more details)

PDB Description: nmr structure of p. aeruginosa protein pa4738: northeast structural genomics consortium target pap2
PDB Compounds: (A:) Hypothetical protein PA4738

SCOPe Domain Sequences for d1ywwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywwa_ a.60.11.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mnsdvikgkwkqltgkikerwgdltdddlqaadghaeylvgklqerygwskeraeqevrd
fsdrl

SCOPe Domain Coordinates for d1ywwa_:

Click to download the PDB-style file with coordinates for d1ywwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ywwa_: