![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.11: Hypothetical protein YjbJ [69047] (2 families) ![]() automatically mapped to Pfam PF05532 |
![]() | Family a.60.11.0: automated matches [254209] (1 protein) not a true family |
![]() | Protein automated matches [254464] (1 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [254993] (1 PDB entry) |
![]() | Domain d1ywwa_: 1yww A: [241078] automated match to d1ryka_ |
PDB Entry: 1yww (more details)
SCOPe Domain Sequences for d1ywwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ywwa_ a.60.11.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mnsdvikgkwkqltgkikerwgdltdddlqaadghaeylvgklqerygwskeraeqevrd fsdrl
Timeline for d1ywwa_: