Lineage for d1yvyb2 (1yvy B:1221-1518)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143188Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 2143189Protein automated matches [196142] (6 species)
    not a true protein
  7. 2143190Species Anaerobiospirillum succiniciproducens [TaxId:13335] [230436] (2 PDB entries)
  8. 2143194Domain d1yvyb2: 1yvy B:1221-1518 [241077]
    Other proteins in same PDB: d1yvya1, d1yvyb1
    automated match to d1ytma2

Details for d1yvyb2

PDB Entry: 1yvy (more details), 2.35 Å

PDB Description: Crystal strucutre of Anaerobiospirillum succiniciproducens phosphoenolpyruvate carboxykinase
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d1yvyb2:

Sequence, based on SEQRES records: (download)

>d1yvyb2 c.91.1.0 (B:1221-1518) automated matches {Anaerobiospirillum succiniciproducens [TaxId: 13335]}
iaamhcsantdlegkntaiffglsgtgkttlstdpkrlligddehgwdddgvfnfeggcy
akvinlskenepdiwgaikrnallenvtvdangkvdfadksvtentrvsypifhiknivk
pvskapaakrviflsadafgvlppvsilskeqtkyyflsgftaklagtergiteptptfs
scfgaafltlpptkyaevlvkrmeasgakaylvntgwngtgkrisikdtrgiidaildgs
idtantatipyfnftvptelkgvdtkildprntyadasewevkakdlaerfqknfkkf

Sequence, based on observed residues (ATOM records): (download)

>d1yvyb2 c.91.1.0 (B:1221-1518) automated matches {Anaerobiospirillum succiniciproducens [TaxId: 13335]}
iaamhcsantdlegkntaiffglsgtgkttlstdpkrlligddehgwdddgvfnfeggcy
akvinlskenepdiwgaikrnallenvtvdangkvdfadksvtentrvsypifhiknivk
pvskapaakrviflsadafgvlppvsilskeqtkyyflsgftaptfsscfgaafltlppt
kyaevlvkrmeasgakaylvntgwngtgkrisikdtrgiidaildgsidtantatipyfn
ftvptelkgvdtkildprntyadasewevkakdlaerfqknfkkf

SCOPe Domain Coordinates for d1yvyb2:

Click to download the PDB-style file with coordinates for d1yvyb2.
(The format of our PDB-style files is described here.)

Timeline for d1yvyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yvyb1