SCOPe 2.04: Domain d1yvyb1: 1yvy B:1002-1220

Lineage for d1yvyb1 (1yvy B:1002-1220)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.0: automated matches [227144] (1 protein)
   not a true family

6. Protein automated matches [226847] (4 species)
   not a true protein

7. Species Anaerobiospirillum succiniciproducens [TaxId:13335] [230434] (2 PDB entries)

8. Domain d1yvyb1: 1yvy B:1002-1220 [241076]
   Other proteins in same PDB: d1yvya2, d1yvyb2
   automated match to d1ytma1

Details for d1yvyb1

PDB Entry: 1yvy, 2.35 Å

PDB Description: crystal structure of anaerobiospirillum succiniciproducens phosphoenolpyruvate carboxykinase

PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d1yvyb1:

Sequence; same for both SEQRES and ATOM records:

>d1yvyb1 c.109.1.0 (B:1002-1220) automated matches {Anaerobiospirillum succiniciproducens [TaxId: 13335]}
slseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgrs
pkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcgan
entrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglnse
tavvfnlaekmqiilntwyggemkkgmfsmmnfylplqg

Timeline for d1yvyb1:

• d1yvyb1 is new in SCOPe 2.04-stable
  
• d1yvyb1 appears in SCOPe 2.05
  
• d1yvyb1 appears in the current release, SCOPe 2.08