SCOPe 2.08: Domain d1yvya1: 1yvy A:2-220

Lineage for d1yvya1 (1yvy A:2-220)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.0: automated matches [227144] (1 protein)
   not a true family

6. Protein automated matches [226847] (5 species)
   not a true protein

7. Species Anaerobiospirillum succiniciproducens [TaxId:13335] [230434] (2 PDB entries)

8. Domain d1yvya1: 1yvy A:2-220 [241074]
   Other proteins in same PDB: d1yvya2, d1yvyb2
   automated match to d1ytma1

Details for d1yvya1

PDB Entry: 1yvy, 2.35 Å

PDB Description: crystal structure of anaerobiospirillum succiniciproducens phosphoenolpyruvate carboxykinase

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d1yvya1:

Sequence; same for both SEQRES and ATOM records:

>d1yvya1 c.109.1.0 (A:2-220) automated matches {Anaerobiospirillum succiniciproducens [TaxId: 13335]}
slseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgrs
pkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcgan
entrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglnse
tavvfnlaekmqiilntwyggemkkgmfsmmnfylplqg

Timeline for d1yvya1:

• d1yvya1 first appeared in SCOPe 2.04
  
• d1yvya1 appears in SCOPe 2.07