SCOPe 2.07: Domain d1yunb_: 1yun B:

Lineage for d1yunb_ (1yun B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (59 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [254992] (3 PDB entries)

8. Domain d1yunb_: 1yun B: [241072]
   automated match to d1k4kd_
   complexed with atp, mg

Details for d1yunb_

PDB Entry: 1yun, 2 Å

PDB Description: Crystal Structure of Nicotinic Acid Mononucleotide Adenylyltransferase from Pseudomonas aeruginosa

PDB Compounds: (B:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d1yunb_:

Sequence; same for both SEQRES and ATOM records:

>d1yunb_ c.26.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gkriglfggtfdpvhighmrsavemaeqfaldelrllpnarpphretpqvsaaqrlamve
ravagverltvdprelqrdkpsytidtlesvraelaaddqlfmligwdafcglptwhrwe
alldhchivvlqrpdadseppeslrdllaarsvadpqalkgpggqitfvwqtplavsatq
irallgagrsvrflvpdavlnyieahhlyr

Timeline for d1yunb_:

• d1yunb_ first appeared in SCOPe 2.04
  
• d1yunb_ appears in SCOPe 2.06
  
• d1yunb_ appears in the current release, SCOPe 2.08