Lineage for d1yunb_ (1yun B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841999Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1842000Protein automated matches [190459] (41 species)
    not a true protein
  7. 1842149Species Pseudomonas aeruginosa [TaxId:287] [254992] (3 PDB entries)
  8. 1842156Domain d1yunb_: 1yun B: [241072]
    automated match to d1k4kd_
    complexed with atp, mg

Details for d1yunb_

PDB Entry: 1yun (more details), 2 Å

PDB Description: Crystal Structure of Nicotinic Acid Mononucleotide Adenylyltransferase from Pseudomonas aeruginosa
PDB Compounds: (B:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d1yunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yunb_ c.26.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gkriglfggtfdpvhighmrsavemaeqfaldelrllpnarpphretpqvsaaqrlamve
ravagverltvdprelqrdkpsytidtlesvraelaaddqlfmligwdafcglptwhrwe
alldhchivvlqrpdadseppeslrdllaarsvadpqalkgpggqitfvwqtplavsatq
irallgagrsvrflvpdavlnyieahhlyr

SCOPe Domain Coordinates for d1yunb_:

Click to download the PDB-style file with coordinates for d1yunb_.
(The format of our PDB-style files is described here.)

Timeline for d1yunb_: