SCOP 1.73: Domain d1qmo.2: 1qmo B:,F:

Lineage for d1qmo.2 (1qmo B:,F:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Field bean (Dolichos lablab), Fril [TaxId:35936] [49914] (1 PDB entry)
   a legume lectin that delays hematopoietic progenitor maturation

8. Domain d1qmo.2: 1qmo B:,F: [24107]

Details for d1qmo.2

PDB Entry: 1qmo, 3.5 Å

PDB Description: structure of fril, a legume lectin that delays hematopoietic progenitor maturation

PDB Compounds: (B:) mannose binding lectin, fril, (F:) mannose binding lectin, fril

SCOP Domain Sequences for d1qmo.2:

Sequence; same for both SEQRES and ATOM records:

>g1qmo.2 b.29.1.1 (B:,F:) Legume lectin {Field bean (Dolichos lablab), Fril [TaxId: 35936]}
aqslsfsftkfdpnqedlifqghatstnnvlqvtkldsagnpvsssagrvlysaplrlwe
dsavltsfdtiinfeistpytsriadglaffiappdsvisyhggflglfpnanXsnvvav
efdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrlsvtsyy
agskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtn

Timeline for d1qmo.2:

• d1qmo.2 first appeared (with stable ids) in SCOP 1.55
  
• d1qmo.2 appears in SCOP 1.71
  
• d1qmo.2 appears in SCOP 1.75
  
• d1qmo.2 appears in the current release, SCOPe 2.08