Lineage for d1qmo.2 (1qmo B:,F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778552Species Field bean (Dolichos lablab), Fril [TaxId:35936] [49914] (1 PDB entry)
    a legume lectin that delays hematopoietic progenitor maturation
  8. 2778554Domain d1qmo.2: 1qmo B:,F: [24107]
    complexed with ca, man, mn

Details for d1qmo.2

PDB Entry: 1qmo (more details), 3.5 Å

PDB Description: structure of fril, a legume lectin that delays hematopoietic progenitor maturation
PDB Compounds: (B:) mannose binding lectin, fril, (F:) mannose binding lectin, fril

SCOPe Domain Sequences for d1qmo.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qmo.2 b.29.1.1 (B:,F:) Legume lectin {Field bean (Dolichos lablab), Fril [TaxId: 35936]}
aqslsfsftkfdpnqedlifqghatstnnvlqvtkldsagnpvsssagrvlysaplrlwe
dsavltsfdtiinfeistpytsriadglaffiappdsvisyhggflglfpnanXsnvvav
efdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrlsvtsyy
agskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtn

SCOPe Domain Coordinates for d1qmo.2:

Click to download the PDB-style file with coordinates for d1qmo.2.
(The format of our PDB-style files is described here.)

Timeline for d1qmo.2: