Lineage for d1yrpa_ (1yrp A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1674829Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1674830Protein automated matches [190417] (19 species)
    not a true protein
  7. 1674960Species Human (Homo sapiens) [TaxId:9606] [187294] (476 PDB entries)
  8. 1675614Domain d1yrpa_: 1yrp A: [241063]
    automated match to d3d14a_
    complexed with dtt

Details for d1yrpa_

PDB Entry: 1yrp (more details), 3.1 Å

PDB Description: catalytic domain of human zip kinase phosphorylated at thr265
PDB Compounds: (A:) death-associated protein kinase 3

SCOPe Domain Sequences for d1yrpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrpa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stfrqedvedhyemgeelgsgqfaivrkcrqkgtgkeyaakfikkrrlsssrrgvsreei
erevnilreirhpniitlhdifenktdvvlilelvsggelfdflaekesltedeatqflk
qildgvhylhskriahfdlkpenimlldknvpnpriklidfgiahkieagnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgetkqetltnisavnydfdeeyf
sntselakdfirrllvkdpkrrmtiaqslehswika

SCOPe Domain Coordinates for d1yrpa_:

Click to download the PDB-style file with coordinates for d1yrpa_.
(The format of our PDB-style files is described here.)

Timeline for d1yrpa_: