Lineage for d1yr2a1 (1yr2 A:38-456)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066277Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2066340Family b.69.7.0: automated matches [227149] (1 protein)
    not a true family
  6. 2066341Protein automated matches [226853] (3 species)
    not a true protein
  7. 2066354Species Novosphingobium capsulatum [TaxId:13688] [254988] (1 PDB entry)
  8. 2066355Domain d1yr2a1: 1yr2 A:38-456 [241061]
    Other proteins in same PDB: d1yr2a2, d1yr2a3
    automated match to d3iula1
    complexed with gol

Details for d1yr2a1

PDB Entry: 1yr2 (more details), 1.8 Å

PDB Description: Structural and Mechanistic Analysis of Two Prolyl Endopeptidases: Role of Inter-Domain Dynamics in Catalysis and Specificity
PDB Compounds: (A:) prolyl oligopeptidase

SCOPe Domain Sequences for d1yr2a1:

Sequence, based on SEQRES records: (download)

>d1yr2a1 b.69.7.0 (A:38-456) automated matches {Novosphingobium capsulatum [TaxId: 13688]}
ppypaspqvplvedhfgekvsdpwrwleadvrtdakvaawvqaqsaytaaylkqlperaa
lekrmkalidyerfglpqrrgasvfyswnsglmnqsqllvrpadapvgtkgrvlldpntw
akdgataldawaasddgrllaysvqdggsdwrtvkfvgvadgkpladelkwvkfsglawl
gndallysrfaepkegqafqalnynqtvwlhrlgtpqsadqpvfatpelpkrghgasvss
dgrwvvitssegtdpvntvhvarvtngkigpvtalipdlkaqwdfvdgvgdqlwfvsgdg
aplkkivrvdlsgstprfdtvvpeskdnlesvgiagnrlfasyihdaksqvlafdldgkp
agavslpgigsasglsgrpgdrhaylsfssftqpatvlaldpatakttpwepvhltfdp

Sequence, based on observed residues (ATOM records): (download)

>d1yr2a1 b.69.7.0 (A:38-456) automated matches {Novosphingobium capsulatum [TaxId: 13688]}
ppypaspqvplvedhfgekvsdpwrwleadvrtdakvaawvqaqsaytaaylkqlperaa
lekrmkalidyerfglpqrrgasvfyswnsglmnqsqllvrpadapvgtkgrvlldpntw
ataldawaasddgrllaysvqdggsdwrtvkfvgvadgkpladelkwvkfsglawlgnda
llysrfaeplnynqtvwlhrlgtpqsadqpvfatpelpkrghgasvssdgrwvvitsseg
tdpvntvhvarvtngkigpvtalipdlkaqwdfvdgvgdqlwfvsgdgaplkkivrvdls
gstprfdtvvpeskdnlesvgiagnrlfasyihdaksqvlafdldgkpagavslpgigsa
sglsgrpgdrhaylsfssftqpatvlaldpatakttpwepvhltfdp

SCOPe Domain Coordinates for d1yr2a1:

Click to download the PDB-style file with coordinates for d1yr2a1.
(The format of our PDB-style files is described here.)

Timeline for d1yr2a1: