Lineage for d1qmo.1 (1qmo A:,E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 943756Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 943894Protein Legume lectin [49904] (23 species)
  7. 943959Species Field bean (Dolichos lablab), Fril [TaxId:35936] [49914] (1 PDB entry)
    a legume lectin that delays hematopoietic progenitor maturation
  8. 943960Domain d1qmo.1: 1qmo A:,E: [24106]
    complexed with ca, man, mn

Details for d1qmo.1

PDB Entry: 1qmo (more details), 3.5 Å

PDB Description: structure of fril, a legume lectin that delays hematopoietic progenitor maturation
PDB Compounds: (A:) mannose binding lectin, fril, (E:) mannose binding lectin, fril

SCOPe Domain Sequences for d1qmo.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qmo.1 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolichos lablab), Fril [TaxId: 35936]}
aqslsfsftkfdpnqedlifqghatstnnvlqvtkldsagnpvsssagrvlysaplrlwe
dsavltsfdtiinfeistpytsriadglaffiappdsvisyhggflglfpnanXsnvvav
efdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrlsvtsyy
agskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtn

SCOPe Domain Coordinates for d1qmo.1:

Click to download the PDB-style file with coordinates for d1qmo.1.
(The format of our PDB-style files is described here.)

Timeline for d1qmo.1: