Lineage for d1qmo.1 (1qmo A:,E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12513Species Field bean (Dolichos lab lab), Fril [49914] (1 PDB entry)
  8. 12514Domain d1qmo.1: 1qmo A:,E: [24106]

Details for d1qmo.1

PDB Entry: 1qmo (more details), 3.5 Å

PDB Description: structure of fril, a legume lectin that delays hematopoietic progenitor maturation

SCOP Domain Sequences for d1qmo.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qmo.1 b.29.1.1 (A:,E:) Lectin {Field bean (Dolichos lab lab), Fril}
aqslsfsftkfdpnqedlifqghatstnnvlqvtkldsagnpvsssagrvlysaplrlwe
dsavltsfdtiinfeistpytsriadglaffiappdsvisyhggflglfpnanXsnvvav
efdtylnpdygdpnyihigidvnsirskvtakwdwqngkiatahisynsvskrlsvtsyy
agskpatlsydielhtvlpewvrvglsastgqdkerntvhswsftsslwtn

SCOP Domain Coordinates for d1qmo.1:

Click to download the PDB-style file with coordinates for d1qmo.1.
(The format of our PDB-style files is described here.)

Timeline for d1qmo.1: