Lineage for d1yqub_ (1yqu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889023Species Escherichia coli [TaxId:562] [230430] (2 PDB entries)
  8. 2889028Domain d1yqub_: 1yqu B: [241059]
    automated match to d1yqqa_
    complexed with gun, po4

Details for d1yqub_

PDB Entry: 1yqu (more details), 3.1 Å

PDB Description: Escherichia coli purine nucleoside phosphorylase II, the product of the xapA gene
PDB Compounds: (B:) Xanthosine phosphorylase

SCOPe Domain Sequences for d1yqub_:

Sequence, based on SEQRES records: (download)

>d1yqub_ c.56.2.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
qfshnplfcidiiktykpdftprvafilgsglgaladqienavaisyeklpgfpvstvhg
hagelvlghlqgvpvvcmkgrghfyegrgmtimtdairtfkllgcellfctnaagslrpe
vgagslvalkdhintmpgtpmvglnddrfgerffslanaydaeyrallqkvakeegfplt
egvfvsypgpnfetaaeirmmqiiggdvvgmsvvpevisarhcdlkvvavsaitnmaegl
sdvklshaqtlaaaelskqnfinlicgflrkia

Sequence, based on observed residues (ATOM records): (download)

>d1yqub_ c.56.2.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
qfshnplfcidiiktykpdftprvafilgsglgaladqienavaisyeklpgfpvselvl
ghlqgvpvvcmkgrghfyegrgmtimtdairtfkllgcellfctnaagslrpevgagslv
alkdhintmpgtpmvglnddrfgerffslanaydaeyrallqkvakeegfpltegvfvsy
pgpnfetaaeirmmqiiggdvvgmsvvpevisarhcdlkvvavsaitnqnfinlicgflr
kia

SCOPe Domain Coordinates for d1yqub_:

Click to download the PDB-style file with coordinates for d1yqub_.
(The format of our PDB-style files is described here.)

Timeline for d1yqub_: