SCOPe 2.07: Domain d1yqna1: 1yqn A:1-156

Lineage for d1yqna1 (1yqn A:1-156)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Escherichia coli [TaxId:562] [69768] (14 PDB entries)
   Uniprot P62617 ! Uniprot P36663

8. Domain d1yqna1: 1yqn A:1-156 [241057]
   Other proteins in same PDB: d1yqna2
   automated match to d3esja_
   complexed with cdp, gpp, mn, zn; mutant

Details for d1yqna1

PDB Entry: 1yqn, 3.11 Å

PDB Description: e. coli ispf double mutant

PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1yqna1:

Sequence; same for both SEQRES and ATOM records:

>d1yqna1 d.79.5.1 (A:1-156) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgmglgiaceavallik

Timeline for d1yqna1:

• d1yqna1 first appeared in SCOPe 2.04, called d1yqna_
  
• d1yqna1 appears in SCOPe 2.06
  
• d1yqna1 appears in the current release, SCOPe 2.08