Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [254759] (6 PDB entries) |
Domain d1yq4b1: 1yq4 B:6-114 [241053] Other proteins in same PDB: d1yq4b2, d1yq4c_, d1yq4d_ automated match to d1yq3b1 complexed with 3np, bhg, f3s, fad, fes, gol, hem, pee, sf4, uq |
PDB Entry: 1yq4 (more details), 2.33 Å
SCOPe Domain Sequences for d1yq4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yq4b1 d.15.4.2 (B:6-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} aatsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrsc regicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd
Timeline for d1yq4b1: