SCOPe 2.05: Domain d1yq4b1: 1yq4 B:6-114

Lineage for d1yq4b1 (1yq4 B:6-114)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [254759] (6 PDB entries)

8. Domain d1yq4b1: 1yq4 B:6-114 [241053]
   Other proteins in same PDB: d1yq4b2, d1yq4c_, d1yq4d_
   automated match to d1yq3b1
   complexed with 3np, bhg, f3s, fad, fes, gol, hem, pee, sf4, uq

Details for d1yq4b1

PDB Entry: 1yq4, 2.33 Å

PDB Description: avian respiratory complex ii with 3-nitropropionate and ubiquinone

PDB Compounds: (B:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d1yq4b1:

Sequence; same for both SEQRES and ATOM records:

>d1yq4b1 d.15.4.2 (B:6-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
aatsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrsc
regicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd

Timeline for d1yq4b1:

• d1yq4b1 first appeared in SCOPe 2.04
  
• d1yq4b1 appears in SCOPe 2.06
  
• d1yq4b1 appears in the current release, SCOPe 2.08