Lineage for d1yq4b1 (1yq4 B:6-114)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934092Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)
  7. 2934093Species Chicken (Gallus gallus) [TaxId:9031] [254759] (6 PDB entries)
  8. 2934101Domain d1yq4b1: 1yq4 B:6-114 [241053]
    Other proteins in same PDB: d1yq4b2, d1yq4c_, d1yq4d_
    automated match to d1yq3b1
    complexed with 3np, f3s, fad, fes, gol, hem, jzr, pee, sf4, uq

Details for d1yq4b1

PDB Entry: 1yq4 (more details), 2.33 Å

PDB Description: avian respiratory complex ii with 3-nitropropionate and ubiquinone
PDB Compounds: (B:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d1yq4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yq4b1 d.15.4.2 (B:6-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
aatsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrsc
regicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd

SCOPe Domain Coordinates for d1yq4b1:

Click to download the PDB-style file with coordinates for d1yq4b1.
(The format of our PDB-style files is described here.)

Timeline for d1yq4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yq4b2