Lineage for d1yq1b2 (1yq1 B:79-205)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714116Species Nematode (Caenorhabditis elegans) [TaxId:6239] [224980] (2 PDB entries)
  8. 2714120Domain d1yq1b2: 1yq1 B:79-205 [241052]
    Other proteins in same PDB: d1yq1a1, d1yq1b1
    automated match to d2on5a2

Details for d1yq1b2

PDB Entry: 1yq1 (more details), 3 Å

PDB Description: Structural Genomics Of Caenorhabditis Elegans: glutathione S-Transferase
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1yq1b2:

Sequence, based on SEQRES records: (download)

>d1yq1b2 a.45.1.0 (B:79-205) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
agktpeeeawvdavhdlfkdflaefkkfaaerrsgksaeevekfrsefflparntyfnil
nglleksnsgfligsditfadlvvvdnlltlknyglfdeseftklaalrekvnsypgike
yiakrpv

Sequence, based on observed residues (ATOM records): (download)

>d1yq1b2 a.45.1.0 (B:79-205) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
agktpeeeawvdavhdlfkdflaefkkfaaerrsgevekfrsefflparntyfnilngll
eksnsgfligsditfadlvvvdnlltlknyglfdeseftklaalrekvnsypgikeyiak
rpv

SCOPe Domain Coordinates for d1yq1b2:

Click to download the PDB-style file with coordinates for d1yq1b2.
(The format of our PDB-style files is described here.)

Timeline for d1yq1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yq1b1