| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.24: Accessory protein X4 (ORF8, ORF7a) [117066] (1 family) ![]() automatically mapped to Pfam PF08779 |
| Family b.1.24.1: Accessory protein X4 (ORF8, ORF7a) [117067] (2 proteins) |
| Protein automated matches [254460] (2 species) not a true protein |
| Species SARS coronavirus [TaxId:227859] [254986] (1 PDB entry) |
| Domain d1yo4a1: 1yo4 A:1-84 [241048] Other proteins in same PDB: d1yo4a2, d1yo4a3 automated match to d1xaka_ |
PDB Entry: 1yo4 (more details)
SCOPe Domain Sequences for d1yo4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yo4a1 b.1.24.1 (A:1-84) automated matches {SARS coronavirus [TaxId: 227859]}
elyhyqecvrgttvllkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrhty
qlrarsvspklfirqeevqqelys
Timeline for d1yo4a1: