Lineage for d1yo4a1 (1yo4 A:1-84)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766721Superfamily b.1.24: Accessory protein X4 (ORF8, ORF7a) [117066] (1 family) (S)
    automatically mapped to Pfam PF08779
  5. 2766722Family b.1.24.1: Accessory protein X4 (ORF8, ORF7a) [117067] (2 proteins)
  6. 2766726Protein automated matches [254460] (2 species)
    not a true protein
  7. 2766727Species SARS coronavirus [TaxId:227859] [254986] (1 PDB entry)
  8. 2766728Domain d1yo4a1: 1yo4 A:1-84 [241048]
    Other proteins in same PDB: d1yo4a2, d1yo4a3
    automated match to d1xaka_

Details for d1yo4a1

PDB Entry: 1yo4 (more details)

PDB Description: solution structure of the sars coronavirus orf 7a coded x4 protein
PDB Compounds: (A:) Hypothetical protein X4

SCOPe Domain Sequences for d1yo4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yo4a1 b.1.24.1 (A:1-84) automated matches {SARS coronavirus [TaxId: 227859]}
elyhyqecvrgttvllkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrhty
qlrarsvspklfirqeevqqelys

SCOPe Domain Coordinates for d1yo4a1:

Click to download the PDB-style file with coordinates for d1yo4a1.
(The format of our PDB-style files is described here.)

Timeline for d1yo4a1: