SCOPe 2.04: Domain d1ympb_: 1ymp B:

Lineage for d1ympb_ (1ymp B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187645] (3 PDB entries)

8. Domain d1ympb_: 1ymp B: [241047]
   automated match to d3hg0d_

Details for d1ympb_

PDB Entry: 1ymp, 2.2 Å

PDB Description: The Crystal Structure of a Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve an Ankyrin Fold

PDB Compounds: (B:) Notch 1 protein

SCOPe Domain Sequences for d1ympb_:

Sequence; same for both SEQRES and ATOM records:

>d1ympb_ d.211.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnnvda
avvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdiaqe
rmhhdivrlld

Timeline for d1ympb_:

• d1ympb_ is new in SCOPe 2.04-stable
  
• d1ympb_ appears in SCOPe 2.05
  
• d1ympb_ appears in the current release, SCOPe 2.08