Lineage for d1ympb_ (1ymp B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685730Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1685731Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1685732Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
  6. 1685821Protein automated matches [190101] (6 species)
    not a true protein
  7. 1685860Species Mouse (Mus musculus) [TaxId:10090] [187645] (3 PDB entries)
  8. 1685866Domain d1ympb_: 1ymp B: [241047]
    automated match to d3hg0d_

Details for d1ympb_

PDB Entry: 1ymp (more details), 2.2 Å

PDB Description: The Crystal Structure of a Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve an Ankyrin Fold
PDB Compounds: (B:) Notch 1 protein

SCOPe Domain Sequences for d1ympb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ympb_ d.211.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnnvda
avvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdiaqe
rmhhdivrlld

SCOPe Domain Coordinates for d1ympb_:

Click to download the PDB-style file with coordinates for d1ympb_.
(The format of our PDB-style files is described here.)

Timeline for d1ympb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ympa_