Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (18 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187645] (3 PDB entries) |
Domain d1ympb_: 1ymp B: [241047] automated match to d3hg0d_ |
PDB Entry: 1ymp (more details), 2.2 Å
SCOPe Domain Sequences for d1ympb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ympb_ d.211.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnnvda avvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdiaqe rmhhdivrlld
Timeline for d1ympb_: