Lineage for d1ylha2 (1ylh A:228-539)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143073Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 protein domains)
  6. 2143124Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68921] (4 species)
  7. 2143125Species Actinobacillus succinogenes [TaxId:67854] [230421] (2 PDB entries)
  8. 2143126Domain d1ylha2: 1ylh A:228-539 [241045]
    Other proteins in same PDB: d1ylha1
    automated match to d1ygga2
    complexed with bme, dt3, fmt, mn, po4, pyr

Details for d1ylha2

PDB Entry: 1ylh (more details), 1.7 Å

PDB Description: Crystal Structure of Phosphoenolpyruvate Carboxykinase from Actinobaccilus succinogenes in Complex with Manganese and Pyruvate
PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d1ylha2:

Sequence, based on SEQRES records: (download)

>d1ylha2 c.91.1.1 (A:228-539) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Actinobacillus succinogenes [TaxId: 67854]}
vasmhcsanvgkdgdvaiffglsgtgkttlstdpkrqligddehgwdesgvfnfeggcya
ktinlsqenepdiygairrdallenvvvradgsvdfddgsktentrvsypiyhidnivrp
vskaghatkvifltadafgvlppvskltpeqteyyflsgftaklagtergvteptptfsa
cfgaaflslhpiqyadvlvermkasgaeaylvntgwngtgkrisikdtrgiidaildgsi
ekaemgelpifnlaipkalpgvdpaildprdtyadkaqwqvkaedlanrfvknfvkytan
peaaklvgagpk

Sequence, based on observed residues (ATOM records): (download)

>d1ylha2 c.91.1.1 (A:228-539) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Actinobacillus succinogenes [TaxId: 67854]}
vasmhcsanvgkdgdvaiffglsgtgkttlstdpkrqligddehgwdesgvfnfeggcya
ktinlsqenepdiygairrdallenvvvradgsvdfddgsktentrvsypiyhidnivrp
vskaghatkvifltadafgvlppvskltpeqteyyflsgftaptptfsacfgaaflslhp
iqyadvlvermkasgaeaylvntgwngtgkrisikdtrgiidaildgsiekaemgelpif
nlaipkalpgvdpaildprdtyadkaqwqvkaedlanrfvknfvkytanpeaaklvgagp
k

SCOPe Domain Coordinates for d1ylha2:

Click to download the PDB-style file with coordinates for d1ylha2.
(The format of our PDB-style files is described here.)

Timeline for d1ylha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ylha1