Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) |
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species) |
Species Actinobacillus succinogenes [TaxId:67854] [230419] (2 PDB entries) |
Domain d1ylha1: 1ylh A:4-227 [241044] Other proteins in same PDB: d1ylha2 automated match to d1ygga1 complexed with bme, dt3, fmt, mn, po4, pyr |
PDB Entry: 1ylh (more details), 1.7 Å
SCOPe Domain Sequences for d1ylha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylha1 c.109.1.1 (A:4-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Actinobacillus succinogenes [TaxId: 67854]} dlnklvkelndlgltdvkeivynpsyeqlfeeetkpglegfdkgtlttlgavavdtgift grspkdkyivcdettkdtvwwnseaakndnkpmtqetwkslrelvakqlsgkrlfvvegy cgasekhrigvrmvtevawqahfvknmfirptdeelknfkadftvlngakctnpnwkeqg lnsenfvafnitegiqliggtwyggemkkgmfsmmnyflplkg
Timeline for d1ylha1: