Lineage for d1ylha1 (1ylh A:4-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920701Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2920766Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species)
  7. 2920767Species Actinobacillus succinogenes [TaxId:67854] [230419] (2 PDB entries)
  8. 2920768Domain d1ylha1: 1ylh A:4-227 [241044]
    Other proteins in same PDB: d1ylha2
    automated match to d1ygga1
    complexed with bme, dt3, fmt, mn, po4, pyr

Details for d1ylha1

PDB Entry: 1ylh (more details), 1.7 Å

PDB Description: Crystal Structure of Phosphoenolpyruvate Carboxykinase from Actinobaccilus succinogenes in Complex with Manganese and Pyruvate
PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d1ylha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylha1 c.109.1.1 (A:4-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Actinobacillus succinogenes [TaxId: 67854]}
dlnklvkelndlgltdvkeivynpsyeqlfeeetkpglegfdkgtlttlgavavdtgift
grspkdkyivcdettkdtvwwnseaakndnkpmtqetwkslrelvakqlsgkrlfvvegy
cgasekhrigvrmvtevawqahfvknmfirptdeelknfkadftvlngakctnpnwkeqg
lnsenfvafnitegiqliggtwyggemkkgmfsmmnyflplkg

SCOPe Domain Coordinates for d1ylha1:

Click to download the PDB-style file with coordinates for d1ylha1.
(The format of our PDB-style files is described here.)

Timeline for d1ylha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ylha2