Lineage for d1ylbb_ (1ylb B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770993Protein automated matches [190545] (9 species)
    not a true protein
  7. 2771039Species Spinach (Spinacia oleracea) [TaxId:3562] [254983] (1 PDB entry)
  8. 2771040Domain d1ylbb_: 1ylb B: [241043]
    automated match to d1ag6a_
    complexed with cu1

Details for d1ylbb_

PDB Entry: 1ylb (more details)

PDB Description: nmr solution structure of the reduced spinach plastocyanin
PDB Compounds: (B:) Plastocyanin, chloroplast

SCOPe Domain Sequences for d1ylbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylbb_ b.6.1.1 (B:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
vevllgggdgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
dllnapgetykvtltekgtykfycsphqgagmvgkvtvn

SCOPe Domain Coordinates for d1ylbb_:

Click to download the PDB-style file with coordinates for d1ylbb_.
(The format of our PDB-style files is described here.)

Timeline for d1ylbb_: