Lineage for d1yjva1 (1yjv A:2-73)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196990Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2196991Protein automated matches [191063] (8 species)
    not a true protein
  7. 2196994Species Human (Homo sapiens) [TaxId:9606] [254969] (11 PDB entries)
  8. 2197000Domain d1yjva1: 1yjv A:2-73 [241041]
    Other proteins in same PDB: d1yjva2, d1yjva3
    automated match to d1s6ua_
    complexed with cu1

Details for d1yjva1

PDB Entry: 1yjv (more details)

PDB Description: solution structure of the cu(i) form of the sixth soluble domain of menkes protein
PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1yjva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjva1 d.58.17.0 (A:2-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdgvlelvvrgmtcascvhkiessltkhrgilycsvalatnkahikydpeiigprdiiht
ieslgfeaslvk

SCOPe Domain Coordinates for d1yjva1:

Click to download the PDB-style file with coordinates for d1yjva1.
(The format of our PDB-style files is described here.)

Timeline for d1yjva1: