![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
![]() | Protein automated matches [191063] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254969] (11 PDB entries) |
![]() | Domain d1yjva1: 1yjv A:2-73 [241041] Other proteins in same PDB: d1yjva2, d1yjva3 automated match to d1s6ua_ complexed with cu1 |
PDB Entry: 1yjv (more details)
SCOPe Domain Sequences for d1yjva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yjva1 d.58.17.0 (A:2-73) automated matches {Human (Homo sapiens) [TaxId: 9606]} gdgvlelvvrgmtcascvhkiessltkhrgilycsvalatnkahikydpeiigprdiiht ieslgfeaslvk
Timeline for d1yjva1: