Lineage for d2sbaa_ (2sba A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042651Species Soybean (Glycine max) [TaxId:3847] [49913] (5 PDB entries)
  8. 2042655Domain d2sbaa_: 2sba A: [24104]
    complexed with ca, mn

Details for d2sbaa_

PDB Entry: 2sba (more details), 2.6 Å

PDB Description: soybean agglutinin complexed with 2,6-pentasaccharide
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2sbaa_:

Sequence, based on SEQRES records: (download)

>d2sbaa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]}
aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlpha

Sequence, based on observed residues (ATOM records): (download)

>d2sbaa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]}
aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnendqvvav
efdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslvyps
qrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlpha

SCOPe Domain Coordinates for d2sbaa_:

Click to download the PDB-style file with coordinates for d2sbaa_.
(The format of our PDB-style files is described here.)

Timeline for d2sbaa_: