Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
Protein automated matches [191063] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [254969] (13 PDB entries) |
Domain d1yjta1: 1yjt A:2-73 [241039] Other proteins in same PDB: d1yjta2, d1yjta3 automated match to d1s6ua_ complexed with cu1; mutant |
PDB Entry: 1yjt (more details)
SCOPe Domain Sequences for d1yjta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yjta1 d.58.17.0 (A:2-73) automated matches {Human (Homo sapiens) [TaxId: 9606]} gdgvlelvvrgmtcascvhkiessltkhrgilycsvalatnkahikydpeiigprdiiht ieslgfepslvk
Timeline for d1yjta1: