Lineage for d1yjta1 (1yjt A:2-73)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2954018Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2954019Protein automated matches [191063] (9 species)
    not a true protein
  7. 2954025Species Human (Homo sapiens) [TaxId:9606] [254969] (13 PDB entries)
  8. 2954036Domain d1yjta1: 1yjt A:2-73 [241039]
    Other proteins in same PDB: d1yjta2, d1yjta3
    automated match to d1s6ua_
    complexed with cu1; mutant

Details for d1yjta1

PDB Entry: 1yjt (more details)

PDB Description: solution structure of the cu(i) form of the sixth soluble domain a69p mutant of menkes protein
PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1yjta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjta1 d.58.17.0 (A:2-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdgvlelvvrgmtcascvhkiessltkhrgilycsvalatnkahikydpeiigprdiiht
ieslgfepslvk

SCOPe Domain Coordinates for d1yjta1:

Click to download the PDB-style file with coordinates for d1yjta1.
(The format of our PDB-style files is described here.)

Timeline for d1yjta1: