Lineage for d1yj8c2 (1yj8 C:216-372)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721881Species Plasmodium falciparum [TaxId:36329] [225360] (5 PDB entries)
  8. 2721891Domain d1yj8c2: 1yj8 C:216-372 [241037]
    Other proteins in same PDB: d1yj8a1, d1yj8b1, d1yj8c1
    automated match to d2plaa2

Details for d1yj8c2

PDB Entry: 1yj8 (more details), 2.85 Å

PDB Description: initial structural analysis of plasmodium falciparum glycerol-3- phosphate dehydrogenase
PDB Compounds: (C:) glycerol-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1yj8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj8c2 a.100.1.0 (C:216-372) automated matches {Plasmodium falciparum [TaxId: 36329]}
tieveicgalkniitlacgfcdglnlptnsksaiirnginemilfgkvffqkfnenille
scgfadiitsflagrnakcsaefikstpkktweeleneilkgqklqgtvtlkyvyhmike
knmtnefplftvlhkisfenedpssllktfmnnkinq

SCOPe Domain Coordinates for d1yj8c2:

Click to download the PDB-style file with coordinates for d1yj8c2.
(The format of our PDB-style files is described here.)

Timeline for d1yj8c2: