![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (26 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [225360] (2 PDB entries) |
![]() | Domain d1yj8b2: 1yj8 B:216-372 [241035] Other proteins in same PDB: d1yj8a1, d1yj8b1, d1yj8c1 automated match to d2plaa2 |
PDB Entry: 1yj8 (more details), 2.85 Å
SCOPe Domain Sequences for d1yj8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yj8b2 a.100.1.0 (B:216-372) automated matches {Plasmodium falciparum [TaxId: 36329]} tieveicgalkniitlacgfcdglnlptnsksaiirnginemilfgkvffqkfnenille scgfadiitsflagrnakcsaefikstpkktweeleneilkgqklqgtvtlkyvyhmike knmtnefplftvlhkisfenedpssllktfmnnkinq
Timeline for d1yj8b2:
![]() Domains from other chains: (mouse over for more information) d1yj8a1, d1yj8a2, d1yj8c1, d1yj8c2 |