SCOPe 2.04: Domain d1yj8b2: 1yj8 B:216-372

Lineage for d1yj8b2 (1yj8 B:216-372)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (26 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225360] (2 PDB entries)

8. Domain d1yj8b2: 1yj8 B:216-372 [241035]
   Other proteins in same PDB: d1yj8a1, d1yj8b1, d1yj8c1
   automated match to d2plaa2

Details for d1yj8b2

PDB Entry: 1yj8, 2.85 Å

PDB Description: initial structural analysis of plasmodium falciparum glycerol-3- phosphate dehydrogenase

PDB Compounds: (B:) glycerol-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1yj8b2:

Sequence; same for both SEQRES and ATOM records:

>d1yj8b2 a.100.1.0 (B:216-372) automated matches {Plasmodium falciparum [TaxId: 36329]}
tieveicgalkniitlacgfcdglnlptnsksaiirnginemilfgkvffqkfnenille
scgfadiitsflagrnakcsaefikstpkktweeleneilkgqklqgtvtlkyvyhmike
knmtnefplftvlhkisfenedpssllktfmnnkinq

Timeline for d1yj8b2:

• d1yj8b2 is new in SCOPe 2.04-stable
  
• d1yj8b2 appears in SCOPe 2.05
  
• d1yj8b2 appears in the current release, SCOPe 2.08