Lineage for d1sbda_ (1sbd A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663616Species Soybean (Glycine max) [TaxId:3847] [49913] (5 PDB entries)
  8. 663619Domain d1sbda_: 1sbd A: [24103]
    complexed with ca, gal, mn, nag

Details for d1sbda_

PDB Entry: 1sbd (more details), 2.52 Å

PDB Description: soybean agglutinin complexed with 2,4-pentasaccharide
PDB Compounds: (A:) soybean agglutinin

SCOP Domain Sequences for d1sbda_:

Sequence, based on SEQRES records: (download)

>d1sbda_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]}
aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlph

Sequence, based on observed residues (ATOM records): (download)

>d1sbda_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]}
aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenedqvva
vefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslvyp
sqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlph

SCOP Domain Coordinates for d1sbda_:

Click to download the PDB-style file with coordinates for d1sbda_.
(The format of our PDB-style files is described here.)

Timeline for d1sbda_: