Lineage for d1sbd__ (1sbd -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371484Species Soybean (Glycine max) [TaxId:3847] [49913] (5 PDB entries)
  8. 371487Domain d1sbd__: 1sbd - [24103]
    complexed with ca, gal, mn, nag

Details for d1sbd__

PDB Entry: 1sbd (more details), 2.52 Å

PDB Description: soybean agglutinin complexed with 2,4-pentasaccharide

SCOP Domain Sequences for d1sbd__:

Sequence, based on SEQRES records: (download)

>d1sbd__ b.29.1.1 (-) Legume lectin {Soybean (Glycine max)}
aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlph

Sequence, based on observed residues (ATOM records): (download)

>d1sbd__ b.29.1.1 (-) Legume lectin {Soybean (Glycine max)}
aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenedqvva
vefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslvyp
sqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlph

SCOP Domain Coordinates for d1sbd__:

Click to download the PDB-style file with coordinates for d1sbd__.
(The format of our PDB-style files is described here.)

Timeline for d1sbd__: